<h2>Scientist Observing changes </h2>
If the population of the species is significantly decreasing then the species could become extinct. The decline in population is due to some factors like less immigration, aging, and decreasing fertility rates. But the most is due to less immigration which causes to decrease population. The extinction of population can be prevented by some serious actions which should be taken government.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Cells because all living organisms have cells
You should have a pizza party