1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
EastWind [94]
3 years ago
15

How might a comparison of the anatomy of two closely related animals such as lizards and snakes provide information about their

evolutionary history?
Biology
1 answer:
jenyasd209 [6]3 years ago
4 0
There are two ways of working out the phylogeny (family tree) of living animals. One is by analyzing their genes; the other is to analyze the extent to which they are similar in form. In either case. the results can then be integrated with the fossil record. In principle, the two approaches should be complementary. Both should lead to a consistent account of how snake and lizard families descended from a single stem. More or less a greater number of shared traits would mean they recently diverged from a common ancestor.
You might be interested in
A scientist observes changes in a population of slow-moving animals over time. She hypothesizes that the population may be decre
Sergeeva-Olga [200]
<h2>Scientist Observing changes </h2>

If the population of the species is significantly decreasing then the species could become extinct. The decline in population is due to some factors like less immigration, aging, and decreasing fertility rates. But the most is due to less immigration which causes to decrease population. The extinction of population can be prevented by some serious actions which should be taken government.

8 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
What is the structure shown in the figure?
Aneli [31]

Answer:

lipids

Explanation:

5 0
3 years ago
Biology is the study of living things. anything that is living is called an organism, which is composed of one or more
larisa86 [58]
Cells because all living organisms have cells
7 0
3 years ago
Brainlest if all done
Bingel [31]
You should have a pizza party
6 0
2 years ago
Other questions:
  • When DNA was discovered, they saw that the strands of the double helix are lined up in the opposite direction of each other. Wha
    5·1 answer
  • Which statement describes a climate condition? The city is covered in snow. A cold front is approaching the city. We had clear a
    14·2 answers
  • What major explanation did Charles Darwin provide? A. He explained how DNA is passed on but did not have evidence of it occurrin
    7·2 answers
  • Within the water cycles, where do individual water molecules stay for the least amount of time?
    15·2 answers
  • What are the generations of computers?
    8·1 answer
  • Which factors changed throughout the experiment? Check all that apply.
    9·1 answer
  • Angelique has several symptoms of pneumonia that her doctor diagnoses as being caused by a virus. Her parents ask for an antibio
    5·2 answers
  • A new crocodile is coming to live at the zoo. The zookeeper is busy getting its new home ready. The crocodile will need to eat,
    15·2 answers
  • Imagine you do a test cross between a purple-flowered pea plant having serrated leaves (a dominant trait) and a white-flowered p
    11·1 answer
  • Provide means of transportation
    10·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!