1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Setler79 [48]
3 years ago
6

Water contained in the food or drink you consume is absorbed from the digestive tract into the bloodstream. There are many route

s by which water can then leave the body, resulting in water loss. Read the statements below and select the correct statements regarding water loss.
A. Water loss through sweating is considered insensible water loss
B. There is no water loss from stool excretion since all the water in stool qgets absorbed by the large intestine
C. The greatest amount of water loss occurs via production of urine by the kidneys.
D. Water loss through breathing (respiration) is a type of insensible water loss.
Health
2 answers:
IceJOKER [234]3 years ago
8 0

Answer:

C. The greatest amount of water loss occurs via production of urine by the kidneys.

Explanation:

Water loss through the production of urine by the kidneys is referred to as sensible water loss.

The kidneys can produce up to one litre of urine a day, sometimes even more or less and this depends on the body's needs which can in turn be influenced by the metabolic rate or the temperature of the environment.

Brums [2.3K]3 years ago
7 0

Answer:

A,D

Explanation:

Water loss from the body is sensible when the water is lost through the normal routes such as urine and faeces and it is insensible when the water is lost through respiration and sweating.

This definition validates options A and D.

B is wrong as water is usually present in the stool even though the body absorbs some.

C is wrong because the amount of water loss in the body varies according to different conditions and activities

You might be interested in
What happens when a team wins the serve in volleyball
rusak2 [61]
Its called a ace. Aces are in alot of games such as ping-pong. Nothing happens, you just get a point.
4 0
4 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
Summarize the relationship between diet and cancer. Include in your discussion cancer promoters, antipromoters and dietary pract
marissa [1.9K]
Processed and red meats, as well as saturated fats in general, may increase risk. Sugar-sweetened beverages may increase risk. Obesity is linked with higher risk for advanced prostate cancer. Higher consumption of dairy products and calcium (> 2,000 mg/day) may increase risk
3 0
3 years ago
Whats the difference between an overbite and an over jet?
nevsk [136]

Answer:

overjet is a horizontal issue and overbite is a vertical issue

4 0
3 years ago
Knowing the formula for water and table salt is an example
NARA [144]

Answer: semantic

Explanation:

8 0
3 years ago
Read 2 more answers
Other questions:
  • Which would be the best resource for someone who is mildly depressed? A.a phsychiatric hospital B.counseling with a psychologist
    12·2 answers
  • Select all that apply. Meat is a rich source of: Vitamin C calcium Vitamin B-12 B-complex vitamins protein iron
    9·1 answer
  • Contaminated laundry should be washed in ___
    11·1 answer
  • Answer correctly or your answer will be removed
    14·1 answer
  • Please read the statement below and select how often the statement is true for you.
    8·2 answers
  • True or false Lacrosse was originally started by the Indians for entertainment, settle dispute, and strengthen young men?
    10·1 answer
  • Which substances in the bones allow, flexibility and hardness respectively ​
    12·1 answer
  • Marta has a very general desire to be healthier. Which is the best first step for her to take in moving toward that goal?
    15·1 answer
  • One-third of all abortions in the united states are ________.
    8·1 answer
  • A student is examining nutrition facts labels to compare four food choices. Which food is the "healthiest?"
    7·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!