Answer: "natural selection" .
_________________________________________
Answer:
As a result of a change in the sequence of nucleotides in a strand of DNA (Deoxyribonucleic acid), the amino acids also change in the final protein which leads to protein malfunction.
Explanation:
As a result of a change in the sequence of nucleotides in a strand of DNA (Deoxyribonucleic acid), the amino acids also change in the final protein which leads to protein malfunction. If insulin does not work correctly, it may not be able to bind to the insulin receptor.
DNA contains genetic information. It has a double helix structure.
Answer:
cellular resperation; ATP;energy;digestive system;circulartory ;energy; glucose; water; carbon dioxyide ; mitocondria
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: i cant find my glasses but as soon as i do i will
help
Explanation:
thank you
