1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Inga [223]
4 years ago
15

Which organs of the digestive tract lack digestive enzymes?

Biology
1 answer:
FinnZ [79.3K]4 years ago
5 0
Esophagus & large intestine 
You might be interested in
The process in which organisms with traits well suited to an environment are more likely to survive and to produce offspring is
nikdorinn [45]
Answer:  "natural selection" .
_________________________________________
4 0
3 years ago
Explain how a change in the sequence of nucleotides in a strand of DNA might cause a protein to malfunction
valkas [14]

Answer:

As a result of a change in the sequence of nucleotides in a strand of DNA (Deoxyribonucleic acid), the amino acids also change in the final protein which leads to protein malfunction.

Explanation:

As a result of a change in the sequence of nucleotides in a strand of DNA (Deoxyribonucleic acid), the amino acids also change in the final protein which leads to protein malfunction. If insulin does not work correctly, it may not be able to bind to the insulin receptor.

DNA contains genetic information. It has a double helix structure.

5 0
3 years ago
Help me quick please, its a test!!
Licemer1 [7]

Answer:

cellular resperation; ATP;energy;digestive system;circulartory ;energy; glucose; water; carbon dioxyide ; mitocondria

Explanation:

 

7 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
DAILY Science
zvonat [6]

Answer: i cant find my glasses but as soon as i do i will

help

Explanation:

thank you

8 0
3 years ago
Other questions:
  • Read the description of evolution by natural selection in this section and describe the role that the environment plays in the t
    15·1 answer
  • How does rough er differ from smooth er?
    6·2 answers
  • The antibiotic penicillin is isolated from
    15·1 answer
  • True or False<br><br> JELLYFISH EVAPORATE IN THE SUN.<br><br><br> TURTLES BARK.
    5·2 answers
  • Asswelll with thissssss please
    9·1 answer
  • What’s an adaptation we could not live with out ?
    14·2 answers
  • In your own words, write the definition of each of the words below. Theory:
    7·1 answer
  • what hormone secreted by the duodenum inhibits secretion of gastric juices and stimulates the release of insulin?
    7·1 answer
  • Which stage of metamrphosis of starts when a caterpillar egg Haches btw this is science
    6·2 answers
  • Give two function of the skull​
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!