I believe it's aerobic exercise.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Fishes use the coral reef for shelter during the day as well as food.
<h3>
Information related to coral reef</h3>
One way that fish interact with a coral reef is that fish hide within the coral. Coral reefs are an important resource for large-bodied fish in the Caribbean. They use the reef for shelter during the day.
Coral reefs are important ecosystems because coral reefs contain a great diversity of life. The color of coral depends on the type of polyp present. Coral polyps are tiny little animals that can live individually, or in large colonies that comprise a coral reef.
Great Barrier Reef is considered as the largest coral reef on Earth. Coastal land development, silt runoff, water pollution by humans, damage from scuba diving, boating, and fishing are the threats to the health of coral reef.
Learn more about coral here: brainly.com/question/1143432
Answer:
Protection from UV radiation
