1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
sdas [7]
4 years ago
6

Thomson's experiments are important because they showed that the ____________ is clearly composed of ____________

Biology
1 answer:
Triss [41]4 years ago
7 0

Answer;

Thomson's experiments are important because they showed that the atom is clearly composed of smaller particles.

Explanation;

J.J. Thomson used magnetic and electric fields to measure the mass-to-charge ratio of a cathode ray particle. Thomson set out to prove that the cathode rays produced from the cathode were actually a stream of negatively charged particles called electrons.

J.J. Thomson's experiments with cathode ray tubes showed that all atoms contain tiny negatively charged subatomic particles or electrons. He proposed the plum pudding model of the atom, which had negatively-charged electrons embedded within a positively-charged "soup."


You might be interested in
Which of the following best describes what would happen if the offspring of a fragrant, red rose bush produced flowers with no s
drek231 [11]
The answer is <span>B. The offspring would not cross-fertilize often with other roses.

Scent and colour of the flowers are important for pollination because they will attract pollinators. Flowers </span>with no scent and small, pale petals will attract much <span>fewer </span>pollinators than flowers <span>with scent and large coloured petals</span>. This means those bushes would not cross-fertilize often with other roses.
However, they would not die from a lack of pollinators, nor would produce seeds by asexual reproduction. Also, they would not yield more fruit than the parent rose, their fruit would probably be very small,
6 0
3 years ago
Read 2 more answers
The sickle-cell allele is pleiotropic (that is, it affects more than one phenotypic trait). Specifically, this allele affects ox
butalik [34]

Answer:

adaptations are compromises

Explanation:

The pleiotropic gene involved in sickle-cell anemia is an example of heterozygous advantage. This means that the heterozygous genotype is favourale over other two genotypes (recessive homozygous and dominant homozygous). Eventhough it has harmful effect (sickle cell disease carrier) heterozygous genotype enables resistance to infection (malaria) and that is why this genotype is still favourable by natural selection. This phenomenon is evidence of compromise between harmful ad benefit.

4 0
3 years ago
Aerobic respiration has three stages: glycolysis, Krebs cycle, and the electron transport chain. what are the end products of th
Yanka [14]

I think it’s A because electrons actually taken up by oxygen molecules to make water.
8 0
3 years ago
Read 2 more answers
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
Is this coffee white or black ?
levacccp [35]
Black the creamer makes it look white along with the side of the cup that it is in and the lighting and your phones picture could also make it different than it looks
4 0
3 years ago
Read 2 more answers
Other questions:
  • Suggest a hypothesis why endotherms have independently evolved a 4-chambered heart if mixing of blood seems not to be a major is
    11·1 answer
  • Two scientists do not agree on which type of grocery bag is better for the environment what is the most likely outcome of the di
    12·1 answer
  • Need help with lining up mutated DNA sequence
    8·1 answer
  • Which of these organisms release carbon dioxide by feeding on dead organic matter such as plants and
    12·1 answer
  • By what process do glucose and fructose bond together to form sucrose (D)? What is the by-product of this reaction?
    6·2 answers
  • En una carta de opinión es fundamental ______ a las opiniones de los otros​
    11·1 answer
  • brochure on food safety which will include cuts, falls, burns and fires, electrical shocks, chemical poisoning, choking and othe
    10·1 answer
  • Under what circumstances would a controlled burn be a good idea? Explain your answer.
    5·1 answer
  • A single layer of irregulary shaped cells are known as the?
    13·2 answers
  • A commercial for a new snack bar promises athletes that it will help them build lean muscle and increase their available energy.
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!