Answer:
the cell is the smallest functional unit
Answer: Sea snakes have many adaptations. Like for instance, they have paddle-like tails to help swim more efficiently, and a special flap of tissue to prevent water from entering its lungs.
Explanation:
They develop these adaptations for survival purposes.
Assume as what happens in a pot of water as it get heats.. hot becomes less dense, rises and cools, becoming more dense then sinks- that's called CONVECTION
So D- is the right answer
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
discovery in 2008 where researchers found the ACTN3 gene known as the super sprinter gene that controls fast twitch muscle fibers in sprinters. this gene is apparent in a lot of sprinters, and we know it is a mutation because about 18% of people today actually have 2 defective ones, thus not having the ACTN3 gene at all.
There's this other famous one where this gene low-density lipoprotein receptor-related protein 5, or LRP5 causes extra bone density. usually when LRP5 is inhibited or impaired, this causes osteoporosis, but when it is mutated a different way, it can cause increased bone density. a bunch of generations of a family had never broken a bone in their life because of this. cool stuff.
There's also this trait originating from Africa that people with the sickle cell anemia, no matter if it is active or not, have some resistance towards malaria, good mutataion.
Explanation:
