Answer:
B) A school of sunfish.
In biology, a population is a number of all the organisms of the same group or species who live in a particular geographical area and are capable of interbreeding
Answer: It's the cells, just without the chloralplast , but animals don't need that because only plant cells have chloralplast. So animals only get theses type of cells if they a herbivores,or omnivores because they eat plants and it helps them survive that way
Explanation:
Because Running water is the leading cause of soil erosion, because water is abundant and has a lot of power. Wind is also a leading cause of soil erosion because wind can pick up soil and blow it far away. Activities that remove vegetation, disturb the ground, or allow the ground to dry are activities that increase erosion.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
