Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The difference is:
a) Positive feedback increases a change while negative feedback reduces a change.
b) Positive feedback occurs specific situations while negative feedback occurs in the body.
c) Positive feedback break down the homeostasis while negative feedback maintain the conditions of homeostasis.
d) Positive feedback has less frequent mechanism while negative feedback has more frequent mechanism.
e) Positive feedback enhances change while negative feedback resists change.
f) Positive feedback has a wider range while negative feedback has a narrow range.
Explanation:
Hope they help.
The medulla oblongata is the center of the brain responsible for circulation and respiration. It helps regulate breathing, digestion, sneezing, swallowing, and heart and blood vessel function.
Answer:
Four haploid gametes are formed
Explanation:
Answer: I'm pretty sure it's the first one
Explanation: I don't know for sure but I'm pretty sure when I learned it they said that extrusive is above ground and intrusive is below ground. Don't take my word for 100% though
