Answer:
Muscle cells are most likely affected by the poison.
Las Ciencias de la Tierra o Geociencias conciernen y engloban las disciplinas que estudian la estructura, morfología, evolución, y dinámica del planeta Tierra. Constituye un caso particular de las ciencias planetarias, que se ocupan ellas del estudio de los planetas del Sistema Solar.
Layering.
Hope this helps (:
-Payshence xoxo
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
