The answer is false. there are five types of biomes.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The correct term to fill in the blank would be pancreas. It is the pancreas that is the primary site for non essential amino acid production in humans. It can be found in the abdomen. There are two functions that the pancreas do. First, it aids in the digestion, an exocrine function. Second, it helps in the regulation of substances inside the body, an endocrine function.
Answer:
it increases the viewing size.
Explanation:
Function of microscope is used to enlarge organisms for better look
Answer:
<h2>The chloroplast is involved in both stages of photosynthesis. The light reactions take place in the thylakoid. There, water (H2O) is oxidized, and oxygen (O2) is released. ... In these reactions, the energy from ATP and NADPH is used to fix carbon dioxide (CO2).</h2>
Explanation:
<h2>hope this helps you</h2><h2>Mark my answer as brainalist</h2>
