1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Arlecino [84]
3 years ago
6

Two geometric figures that are identical in shape, although not necessarily the same size, are called ____.

Mathematics
2 answers:
melisa1 [442]3 years ago
6 0
They are called similar.
poizon [28]3 years ago
5 0
They are called similar Similar if they are the same shape and size they are congruent.
You might be interested in
Use the diagram and given information to answer the questions and prove the statement.
Greeley [361]

Answer:

See explanation

Step-by-step explanation:

<u> ASA Postulate (Angle-Side-Angle):</u>

If two angles and the included side of one triangle are congruent to the corresponding parts of another triangle, then the triangles are congruent.

Consider triangles XYB and ZYA. In these triangles

  • ∠X≅∠Z (given)
  • XY≅ZY (given)
  • ∠Y is common angle

By ASA Postulate, triangles XYB and ZYA are congruent. Congruent triangles have congruent corresponding sides, so

BX≅AZ

6 0
3 years ago
$4,700 is invested in an account earning 6.2% interest (APR), compounded
pickupchik [31]

Answer:

(5 x (-20)) * (100 x (0.7))

4 0
2 years ago
The sum of two numbers is fourteen. One number is two less than three times the other. Find the numbers.
Margarita [4]
So, for the first variable, you would use x, and for the second, y. Then, you would write out 2-(3y)=14. once this is done, youd simplify to 2-3y=14. Subtract 2 from both sides to get 3y=12. Then, divide both sides by 3. this will leave you with y=4. From this you can see the other number is ten. Hope this helped! and i apologize if it is incorrect!
7 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
2 years ago
Read 2 more answers
15 is 10 % of what number
Len [333]

15*10=150

15 is 10% of 150

4 0
3 years ago
Other questions:
  • A fruit company delivers its fruit in two types of boxes: large and small. a delivery of 5 large boxes and 3 small boxes has a t
    13·1 answer
  • Turtle walked 1/8 of a mile in 1/2 of an hour. How many miles will the turtle wall in one hour?
    15·1 answer
  • Identify corresponding sides RGK=MQB
    10·1 answer
  • Which transformation(s) can map TriangleMNQ onto TrianglePQN?
    6·2 answers
  • I need to solve this 1/4(-8y)-3x+9y-x
    12·1 answer
  • What is the correct division equation that explains the problem, there are 5 batches of cookies that require 10 cups of flour, s
    7·2 answers
  • What is the slope of the graph?
    9·1 answer
  • Mr. Donovan bought a shirt for $18.47<br> and pants for $25.95. How much<br> money did he spend?
    7·1 answer
  • 7. Using the distance formula, calculate how far Hector threw the ball. (4 points: 2
    7·1 answer
  • Sketch the graph of y = –1.5(4)x. Then state the function’s domain and range.
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!