1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
fenix001 [56]
3 years ago
12

Explain why some people think that indirect sunlight will not cause skin damage.

Health
1 answer:
Jobisdone [24]3 years ago
3 0
We were created to need sun light to survive. we need the Vitamins that come from the sun.
You might be interested in
Christina is energized by being around people. Which Big Five trait describes this?
LenaWriter [7]

Answer:The Big Five trait that describes this would be <u>extraversion. </u>

Explanation:

The Big Five traits is a theory that is used to decide a person's personality trait. The five main traits are; extroversion, agreeableness, conscientiousness, neuroticism, and openness to experience.

Extraversion is when a person is outgoing, talkative, happy to meet others, and energetic around others.

5 0
4 years ago
6. Type 2 diabetes has increased in teens and children. Which factor has contributed most to this
LUCKY_DIMON [66]

Answer:

C. eating fruits / foods with higher sugar content

7 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
If you have a food that contains 4 grams of protein, 6 grams of carbohydrates, and 4 grams of fat, how many calories would be in
vodomira [7]

The answer to your question is,

126 calories. 9 cals per gram.

-Mabel <3

5 0
3 years ago
Please help ASAP!!!
pav-90 [236]

Answer:

The safest method to improve stretching is a combination of Dynamic and Static Stretching.

Explanation

I have already did the Unit for Health on Edge 2020

6 0
3 years ago
Other questions:
  • The teacher uses this accident as a way to talk to students about responding to injuries. What does she suggest to the students
    16·3 answers
  • Many aged 15-24 do not know they are infected because they have no symptoms.
    14·1 answer
  • Which is your body’s ability to destroy pathogens that it has previously encountered before these pathogens can cause disease?
    8·2 answers
  • What does the formula "220 - your age" tell you?
    8·2 answers
  • When Linda thinks she has hit a plateau, she should _____.
    13·2 answers
  • Select all that apply. Every kitchen should be equipped with a: fire extinguisher smoke detector telephone garbage can
    15·2 answers
  • The brains of college-age marijuana users and non-users are the same. True or false
    12·1 answer
  • 3. Create at least one goal for each of the following wellness categories. Personalize each of your goals for the time enrolled
    15·1 answer
  • Abstaining from tobacco and drug use is part of maintaining good physical health.
    8·1 answer
  • Energy balance: energy intake equals energy output (calories in versus calories burned) is a guideline and not an exact equation
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!