D nucleotides. which have nitrogen, carbon and a phosphate group
<h2>Phylum Anthophyta</h2>
Explanation:
Phylum Anthophyta is the phylum of flowering plants.
Bryophytes are group of seedless non-vascular plant.They are called the amphibians of plant kingdom because to complete their life cycle, they need both water and land.
Anthophyta are dominant group than the bryophyta because:
- They have a well developed vascular system.
- They have their seeds enclosed within fruits and protective sed coat that keep them viable for a long time.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Macronutrients are, in the most basic terms, the components of food that ... gram, and that's not including the additional calories from sugary additives, etc. ... absorbed by the body, making it possible for you to still be deficient.
