1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
blsea [12.9K]
3 years ago
11

9. Which international organization helps the United States conduct its foreign policy

Health
2 answers:
S_A_V [24]3 years ago
7 0
The United Nations.
That would be the biggest contributor.
Hope this helps :)
Kipish [7]3 years ago
5 0
United Nations. 95% sure it is correct.
You might be interested in
Should i shower everyday?
Naily [24]
Well it depends, if you sweat a lot then yes shower is need everyday! Now if youre basic... I suggest showering Monday-Wednesday-Friday and deodorant!
3 0
3 years ago
Read 2 more answers
To get the nutritional benefits, different types of plant based protein sources must be consumed at the same meal.
salantis [7]

Answer:

True

Explanation:

It's for the very same reason you have food combos and assorted meal plates

3 0
2 years ago
_____ body weight includes muscles, vital tissues, organs and bone <br> (Lean or fat?)
Kruka [31]

Answer:

Lean

Explanation:

3 0
3 years ago
Why is it important to choose skin care products based on skin type?
enyata [817]

Answer:

it is important to choose skin care products based on skin type because

1. you'll be wasting money on stuff not for your skin type

2. products not for your skin type may not work

3. you may have a bad reaction to products that aren't for your skin type

5 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
Other questions:
  • How many bones are in the human foot?
    9·1 answer
  • What equipment should a food worker used to reheat a baked potato
    12·1 answer
  • FCS Questions!
    13·2 answers
  • How do I avoid miscarriages and tumors?
    9·1 answer
  • Mrs. Paterson is concerned about the deductibles and co-payments associated with Original Medicare. What can you tell her about
    11·1 answer
  • Alex injured her ankle while ice skating. An X-ray reveals no bone abnormality, but her doctor feels she's damaged ligaments. Wh
    8·1 answer
  • People’s behavior changes when they know they are being observed. This is known as _______; it is also called the _______ effect
    5·1 answer
  • 4. You obtain a SAMPLE history from a
    8·2 answers
  • Which of the following best describes how much precipitation and evaporation occurs over the ocean?
    12·1 answer
  • ¿por qué el estudio de la célula es tan importante para los investigadores?​
    10·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!