4 years ago

How would you start a healthy diet?

Health

2 answers:

Keith_Richards [23]4 years ago

5 0

Do not eat thing with a lot of sugar also eat low fat proteins

anygoal [31]4 years ago

3 0

I would start by setting a goal. Let's say to run six miles a day. Not only would I healthier, my heart would be very healthy too! Secondly, I'd put away the fast food. I'd make a garden and only eat from that. I would eat chicken though because it has lots of protein in it! I'd eat fresh fruit and veggies straight from the garden. This way, it would have less germs.

You might be interested in

Kavi raskhan Pathar ke roop Mein Kiska Ansh Banna Chahte Hain

Delvig [45]

Answer:

ENGLISH................PUT IN ENGLISH

Explanation:

6 0

3 years ago

What is an example of a food safety program an operation needs?

Semenov [28]

Personal Hygiene Program
I think this is right

5 0

3 years ago

A generally healthy man in his forties is curious about "little raised yellow spots" on his buccal mucosa. He has noticed them i

podryga [215]

Answer: Fordyce Granules

Explanation:

Based on the information given in the question, then we can infer that the area is most likely Fordyce Granules.

Fordyce Granules is also referred to as Fordyce spots, and they're little pimple-like structures which are formed on the human body. These pimple-like structures can be seen usually on the male genitalia, around the testicles. They can also be found in th female genitalia, around labia.

6 0

3 years ago

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0

2 years ago

A person who doesn't have enough calcium in his or her diet is at risk for developing bones that are weak and break easily. T

elena-14-01-66 [18.8K]

It is called Osteogenesis