Answer:
- range: {-5, 1, 4, 5}
- domain: {-5, -3, 0, 2}
Step-by-step explanation:
The range is the set of second numbers of the ordered pairs.
{-5, 1, 4, 5}
__
The domain is the set of first numbers of the ordered pairs.
{-5, -3, 0, 2}
__
<em>Additional comment</em>
It is generally convenient to write the elements of a set in sorted order.
Nope he’s not
3x + 7x = 10x
2+4= 6
So the answer is 10x + 6 not whatever Ahmed got
42. The mean is the total of the numbers divided by the amount of numbers. In this case the amount of numbers is 7 and the mean is 6. That means that the total of the numbers divided by 7 equals 6. To find the total you just do the opposite, multiply 7 by 6 and you get 42.
Answer:
egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw
Answer:
a(87) = -590
Step-by-step explanation:
Notice how each term of this arithmetic sequence is equal to the sum of the previous term and the common difference, -12.
The general formula a(n) = a(1) + (n - 1)d becomes:
a(n) = 12 - 7(n - 1)
and the 87th term a(87) = 12 - 7(87 - 1), or
a(87) = 12 - 7(86)
a(87) = -590
