In the situation, when Chuck thinks that attractive women will not be a good educator his attitude toward attractive women is stereotype that once a woman is beautiful she is not smart as maybe all she thinks is just her looks.
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
Parental neglect I think is the answer
<span>What is hydrotherapy ?
Hydrotherapy is the use of water in the treatment of various conditions, including arthritis and rheumatic disorders <span>associated.</span></span>
There are a few conclusions one could come to after logging their food intake. 1. That they need to eat more and aren’t eating enough. 2. That they should eat a little less and are probably eating too much. 3. That they need more variation and balance in their diet. 4. That they need more carbs, fat, protein, fruit, veg, etc