1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
kari74 [83]
3 years ago
8

What activity/activities contribute(s) to making the human species the most significant agent of environmental change on Earth

Biology
2 answers:
IrinaVladis [17]3 years ago
4 0

Answer:

  • <u>The Being with intelligence:</u>

The Human beings are primates. There first humans originated some million of years ago in a pre-historic world. Humans possessed the instinct to survive, for that reason humans started communicating with each other by using the sign languages.Now,there was a sense of communication between them. After which humans started haunting in groups and started living in a significant area they called as there territory.These features made humans very much different from other being, because they had the sense to survive and differentiate between some thing right or wrong.

  • <em>But, as time passed humans made some mistakes and because some of there activities also damaged and some how destroyed the environment, along with the factors that supports life.</em>

Explanation:

  • <u>Humans took natural resources for granted:</u>

Humans took the natural resources for granted as they thought all of the factors of the environment will be forever regenerating through time to time. Humans the ecological cycle and did even spare clean reservoir of water. As now a days there is a lack of clean water in most of region and that is due to mixing of industrial waste products with the clean water reservoir.

  • <u>Increase of industrialization leading to environmental issues:</u>

As humans evolved through time, they had different ways and procedure to improve their life style. But humans forgot that they are destroying the balance in the ecological system. From the past few hundred years humans developed the industrial zones in order to increase the productivity level for obtaining the enough materials to live and use.

  • <u>Consequences of high rate of industrialization:</u>

The consequences of high rate of industrialization led humans to verge of extinction. As the protective layer called as  Ozone is now damaged to severe parameters. Along we that we no more have large ice caps in the Atlantic region, which is also due to rise in the temperature on a global scale.

  • <u>Human the agent for extinction of many species:</u>

Humans had a very hard time with not haunting the species which were on verge of extinction. And it led most of the species to an unfortunate extinction. In a the past there were white rhinos and many species of fish, which were haunted by the humans to a limitless extent until they got vanished from the face of earth.

natita [175]3 years ago
3 0

Answer:

Answer:

Industrialization

Human impact on the environment

The more industries created, the more the levels of population of the environments,

Activities of man on the environment from  damaging of ozone layers, to effect on greenhouse gasses also leads to environmental change

The Industrialization  which leads to destruction and clearing of the  forests  affects the ecosystem by  leading to global warming,through  increase in  atmospheric C02.

Completed Question.

a) urbanization b) people overpopulation c) industrialization d) international fertility rates e) human impact on the environment

You might be interested in
What chemical speeds up the process of decomposition when dead organisms are exposed to it?
Kazeer [188]
Oxygen is the primary chemical in the decomposition of organic organisms 

8 0
3 years ago
How are the based-pairing rules different for RNA then DNA
DedPeter [7]
The “bases” of RNA differ from those of DNA in that thymine (T) is replaced by uracil (U) in RNA. ... In DNA/RNA base pairing, adenine (A) pairs with uracil (U), and cytosine (C) pairs with guanine (G).
4 0
3 years ago
Which of the following is a nonrenewable resource?
Karo-lina-s [1.5K]
Hi there!

A nonrenewable resource is when you use something once, it cannot be used again, natural gases is an example.

Using this information, C. Coal is your answer.

Hope this helped! ♥♥
7 0
3 years ago
Read 2 more answers
Scientific Method
Dmitry [639]

For your answer, I am sure your blank is "analyze". This is because you must analyze or "look over" your data that has been collected.

3 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • Tropical forests contain dense trees, which allow less sunlight to penetrate. Emergent trees are trees that grow to a height of
    5·2 answers
  • Which of the following is true about the Calvin cycle?
    14·1 answer
  • Two purple flowers (Bb) are bred with each other in the same garden. What are the odds that red (BB) and blue (bb) flowers will
    12·1 answer
  • A typical human cell has 90,000 insulin receptors. If a genetic error occurred,resulting in each liver cell in a person having o
    11·1 answer
  • The beginning of anaphase is indicated by
    14·1 answer
  • Identify the structural class of each gland described here 1. flask shaped gland unbranched ducts slender, straight gland unbran
    11·1 answer
  • A group of researchers discovered the fossilized remains of a flying mammal that appears to have lived 130 million to 165 millio
    14·1 answer
  • Marisol is trying to get to work on time. She's walking to the bus
    15·1 answer
  • Many birds migrate to warmer climates in the spring. Find two reasons why. Group of answer choices To get away from seasonal pre
    10·1 answer
  • A theme is a(n)___musical idea<br><br>A. shortened<br>B. complete <br>C. partial<br>D. staccato<br>​
    11·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!