1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
svlad2 [7]
3 years ago
13

Jorgen Grace made deposits of $250 at the end of each year for 12 years. The rate received was 6% annually. What is the value of

the investment after 12 years? $2,028 $3,000 $4,217.48 $4,200 None of these
Mathematics
1 answer:
lakkis [162]3 years ago
8 0

As given, Amount or A = 250

Time period = 12 years or n=12

Interest = 6% or i=0.06

Value of the investment = A[((1+i)^{n}-1)/i]

= 250[((1+0.06)^{12}-1)/0.06]

= 250[((1.06)^{12}-1)/0.06]

= 250[(2.0121-1)/0.06]

= 250(16.869) = 4217.25 which is near to $4217.48

Hence, option C = $4217.48 is the answer.

You might be interested in
A stack of 500 sheets of paper is 3 inches in height.What is the thicknrss of one sheet of paper,in inches?Answer with supportin
zhuklara [117]
3 inches / 500 pages = .006 inches per page?
5 0
3 years ago
1. 10 metres of cloth cost 1000 Rs. What will be the cost for 4 metres
german

Answer:

a

Step-by-step explanation:

10 -- 1000

1 -- 100

4 -- 400

5 0
3 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
Write the equation y=4x+9 in standard form using integers.
rosijanka [135]

Answer:

4x-y=-9

Step-by-step explanation:

The standard form of an equation is when both variables, x & y, are on the same side of the equation with a number on the other side.

To transform this equation from slope-intercept form to standard form, just switch sides for the y and the 9 like follows.

4x-y=-9

I hope this helped you :D

4 0
3 years ago
Distribute the problem <br> 2(3-8y)
77julia77 [94]

Answer:

<h3>6-16y</h3>

Step-by-step explanation:

Hello!

apply distributive law

a(b - c) = ab - ac

2(3-8y)=2.3-2.8y

  • 2.3=6
  • -2.8y= -16y

=6-16y

Hope it helps!

6 0
1 year ago
Other questions:
  • How would you solve 4n-2n=4?
    11·2 answers
  • -2/3(8+1/2) please tell me whats the answer
    7·2 answers
  • Mrs. Carpenter received a bill for a car repairs. :Car repairs $134.00: About how much was the oil change if the other repairs w
    12·1 answer
  • The school hall is 4 times as long as it is wide. If the perimeter is 55m, what is the length? and what is the width?
    12·1 answer
  • Promise for brainliest plzz anyone answer if u know this!!!!!!!! What are the next three terms in the sequence?
    9·1 answer
  • ∠A and
    6·1 answer
  • PleaseASAP please I’ll mark you as brainlister
    6·1 answer
  • Flying against the wind, an airplane travels 3360 kilometers in hours. Flying with the wind, the same plane travels 7560 kilomet
    5·1 answer
  • Multiplication between exponentiation number 648
    12·1 answer
  • N/10+3=9 solve for N
    15·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!