morphine that is broken up into small quantities
Answer and Explanation:
Due to technical problems, you will find the complete answer and explanation in the attached files
Answer:
The Mid-Atlantic Ridge (MAR) is a mid-ocean ridge, a divergent or constructive plate boundary located along the floor of the Atlantic Ocean, and part of the longest mountain range in the world.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Photosynthesis takes place<span> inside plant cells in small things called chloroplasts. Chloroplasts (mostly found in the mesophyll layer) contain a green substance called chlorophyll. Below are the other parts of the cell that work with the chloroplast to make </span>photosynthesis happen<span>.</span>
