1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
olya-2409 [2.1K]
3 years ago
11

Who can help him with his problem​

Health
2 answers:
kompoz [17]3 years ago
8 0

Answer:

whose problem is it , add more of the question

tiny-mole [99]3 years ago
5 0

Answer: What is his problem?

Explanation:

You might be interested in
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
Thermometers used in the kitchen do not contain mercury <br> True or False
Anit [1.1K]
False they do not contain mercury
8 0
3 years ago
Read 2 more answers
Always<br> use a<br> finger sweep on a choking child.<br><br> True<br> False
telo118 [61]

Answer:

False

Explanation:

You should not use a finger sweep on a choking child unless you can see the thing they are choking on then you can try a finger sweep otherwise it could cause further blockage in the throat

3 0
3 years ago
Read 2 more answers
How does your Tidal Volume compare with the average Tidal Volumes found in Table 4-2?
Vaselesa [24]

Answer:

Tidal volume is the volume of gas that is moved in and out of the lungs per breath. The normal tidal volume is 6 to 8 ml/kg, regardless of age.

Explanation:

6 0
3 years ago
In the movie Osmosis Jones how is the nervous system represented
Evgen [1.6K]

Answer:

As an electric power grid

Explanation:

When Osmosis Jones misses his shot he hits the nervous system which is then represented as an electric power grid. This sets off very strong cramps in Frank. This is pretty interesting because the nervous system works like that. It sends electrical impulses down the cells and that is how information passes through the body.

3 0
3 years ago
Other questions:
  • How can a straightedge spatula and rubber scraper help when measuring foods
    12·1 answer
  • Which of the following processes does the body NOT use protein to perform? A. repairing muscles B. producing hormones C. making
    9·2 answers
  • Football is an excellent activity for the development of cardiovascular fitness.
    15·1 answer
  • A patients sore throat is cause by a streptococcus. how would it be treated?
    8·1 answer
  • Question 2 (Multiple Choice Worth 3 points)
    12·2 answers
  • Which is a controllable health risk factor?
    5·2 answers
  • How to get food poisoned
    10·2 answers
  • Which of the following is not included in the GREAT decision making model?
    10·1 answer
  • A son grows to be 6'4", a similar height as his father who is 6'5". Which of the following best describes why this happened?
    13·1 answer
  • Signs of stress are different in everyone, some people express more physical signs, like ________________ or _________________ _
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!