1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
zzz [600]
3 years ago
5

A circular molecule of DNA contains 1 million base pairs. If the DNA synthesis at a replication fork occurs at a rate of 100,000

nucleotides per minute, how much time will theta replication require to completely replicate the molecule, assuming that theta replication is bidirectional?
Biology
1 answer:
lakkis [162]3 years ago
4 0

Answer:

<h2>5 minutes </h2>

Explanation:

1. In bidirectional replication;  there are two replication forks, and each proceeding at a rate of 100,000 (as given in the question) nucleotides per minute.  

2. So, by  the given rate of replication, we can calculate that, it would require 5 minutes for the circular DNA molecule to be replicated by bidirectional replication because each fork synthesize  500,000 nucleotides in 5 minutes ( 100,000 per minute) ( as given, in 5 minutes × 100,000 nucleotides per minute= 500,000 and by 2 forks= 1,000,000) within the time period.  

You might be interested in
What is electrophoresis used for
xeze [42]

Gel electrophoresis is a technique used to separate DNA fragments (or other macromolecules, such as RNA and proteins) based on their size and charge. Electrophoresis involves running a current through a gel containing the molecules of interest.

4 0
3 years ago
Read 2 more answers
Which of the following is NOT an accurate justification for studying microbes?
Burka [1]
The answer would be B, because they have subcellular organelles.
5 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Compare the manner in which grasshopper hears to the way a human hears
Arturiano [62]
Grasshoppers have no ears, instead they use an organ called the tympanum located in the first segment of their abdomen, whereas humans take in sound waves through the ear canal until they reach the eardrum. The eardrum picks up the vibrations and then transmits them to tiny bones in the middle of the ear, the bones pass the vibrations to the inner ear (which is filled with liquid) and the cochlea.

Hope I could help.
8 0
4 years ago
Fill in the blanks to make the following statement true
Arisa [49]

Answer:An inherited, natural selection.

Explanation: Adaptation is the process through which living organisms develop mechanisms this mechanisms may be Inherited to enable them survive competition and other prevailing circumstances. Which can also be environmental, climatic factors etc.

Adaptation helps to ensure the principle of NATURAL SELECTION,where organisms which have been able to develop similar mechanisms or have natural mechanisms that has enabled them to survive the prevailing circumstances in the habitat.

4 0
3 years ago
Other questions:
  • Why are mammals more closely related to birds than to amphibians?
    6·1 answer
  • Humans raise large numbers of cattle for food. How will these herds of cows affect
    13·2 answers
  • What is a possible consequence of ozone layer depletion on living organisms?
    10·1 answer
  • State four importance of water to organisms in the tropical rainforest.<br>​
    11·1 answer
  • Dinobryon is a species of protozoa that reproduce asexually. How can this asexual reproduction be harmful to the species? A.They
    8·2 answers
  • Plz help!!!
    11·1 answer
  • In Journey to the Center of the Earth, by Jules Verne, an adventurer travels through the layers of Earth until he reaches the ce
    14·1 answer
  • Cómo se denominan las células ideas? ¿En dónde se localizan?​
    15·1 answer
  • In what phase do mosses spend most of their life cycle?
    6·1 answer
  • A histologist examines tissue that was found holding one bone to another. What term best describes this tissue?
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!