Gel electrophoresis is a technique used to separate DNA fragments (or other macromolecules, such as RNA and proteins) based on their size and charge. Electrophoresis involves running a current through a gel containing the molecules of interest.
The answer would be B, because they have subcellular organelles.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Grasshoppers have no ears, instead they use an organ called the tympanum located in the first segment of their abdomen, whereas humans take in sound waves through the ear canal until they reach the eardrum. The eardrum picks up the vibrations and then transmits them to tiny bones in the middle of the ear, the bones pass the vibrations to the inner ear (which is filled with liquid) and the cochlea.
Hope I could help.
Answer:An inherited, natural selection.
Explanation: Adaptation is the process through which living organisms develop mechanisms this mechanisms may be Inherited to enable them survive competition and other prevailing circumstances. Which can also be environmental, climatic factors etc.
Adaptation helps to ensure the principle of NATURAL SELECTION,where organisms which have been able to develop similar mechanisms or have natural mechanisms that has enabled them to survive the prevailing circumstances in the habitat.
