It is true if that's what you're asking.
Tad poles have gills that help them breathe underwater. frogs have lungs that help them breathe underwater. tadpoles have tails and fins to help them swim underwater. frogs have arms and legs to help them swim.
don't do drugs in the first place
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
C. Loss of calcium.
Kwashiorkor is a protein malnutrition.
Marasmus is a protein deficiency.
Loss of Vitamin C is just Vitamin C deficiency, also known as scurvy or scorbutus.