1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
olganol [36]
3 years ago
12

Alex has evaluated her skills and determined that she has excellent power. She wants to sign up for two sports that will play to

her strengths. Which two sports will be best for her?
Bicycling and soccer

Tennis and gymnastics

Swimming and football

Volleyball and archery

Health
2 answers:
Semmy [17]3 years ago
6 0

The two sports that would be best suited to Alex would be tennis and gymnastics.

Both sports involve using the entire body and are physically demanding. Tennis uses legs, feet, hips to stand and run around the court while the arms, hands and shoulders are used to carry the racket and hit the ball back to the opponent with a significant amount of force. Physical strength is a key factor to playing Tennis. Gymnastics again uses the whole body and takes a lot of physical strength to push your body to jump, run, balance, spin, swing and so forth.

Aleksandr-060686 [28]3 years ago
3 0

Answer:

Tennis and Gymnastics

Hope this helped :)

You might be interested in
It is important to wear protective equipment in both practice and games
Elodia [21]
It is true if that's what you're asking.
3 0
3 years ago
Read 2 more answers
What are ways that a tadpole and a frog are differnt
lorasvet [3.4K]
Tad poles have gills that help them breathe underwater. frogs have lungs that help them breathe underwater. tadpoles have tails and fins to help them swim underwater. frogs have arms and legs to help them swim.
3 0
3 years ago
Read 2 more answers
How can people help prevent drug abuse and addiction
Lostsunrise [7]

don't do drugs in the first place


4 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
Excess dietary protein can cause _______.
Ber [7]
C. Loss of calcium.
Kwashiorkor is a protein malnutrition.
Marasmus is a protein deficiency.
Loss of Vitamin C is just Vitamin C deficiency, also known as scurvy or scorbutus.
3 0
3 years ago
Other questions:
  • Mental health professionals such as psychiatrists, psychologists, and social workers can help people cope with depression. What
    5·1 answer
  • Which living creature would help your emotional health the best?
    11·1 answer
  • 25 POINTS + BRANLIEST Discuss HIV and AIDS as a scientist and a social worker
    12·2 answers
  • The ability of a muscle or muscle group to exert force against resistance for a long period of time.
    10·1 answer
  • How would you define the term health
    5·1 answer
  • How would you respond when a patient asks, "Do you think I am too far?"​
    8·2 answers
  • Your Environment...
    12·2 answers
  • What is a nutrient used for many body processes?
    11·2 answers
  • The Coggin’s test checks for the presence of in horses.
    9·2 answers
  • Pls need an answer asap!!<br><br><br><br> ---------------------------------
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!