1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Helen [10]
3 years ago
6

Select the correct answer.

Health
2 answers:
geniusboy [140]3 years ago
7 0
Fresh wild haddock steaks
zhannawk [14.2K]3 years ago
6 0

I fresh wild haddock steakks

You might be interested in
Pls someone help me : why do I always feel lonely and want to talk to someone badly, I don't have friends (I have one but we rar
mestny [16]

Answer:

Cuz ur lonely, nd u want to express ur feelings to someone.

If u want I am there for u, talk to me.

I won't get tired, to listen to u

Explanation:

Stay safe, stay healthy and blessed

Have a good day !

Thank you

6 0
2 years ago
Read 2 more answers
You observe a high proportion of malarial infections in a small village located in Angola. Malaria is caused by the protozoan Pl
Solnce55 [7]

Answer:

  • To control or break the epidemiological triangle of malaria, 'the biological vector can be controlled through chemical larvicides', Chemical larvicides are chemicals that kill the larva mostly used for killing mosquitoes and here in case of malaria too vector is mosquito so it can be controlled by chemical larvicides.
  • The relocation of village to nearby village is somehow a hectic work, but could be done if no other repellent of malaria is available.
  • 'Instructing the residents on personal protective measures, such as bed netting and use of DEET repellent' is also an effective measure to break this epidemiological triangle of malaria. Apply repellents on skin and use of netted beds keep the vectors away for as much time as possible, so it would prove to be effective.

6 0
3 years ago
Owning provides _________ flexibility but can lead to _________ costs in the long-term.
Aleksandr [31]
Owning provides a greater flexibility but can lead to lower costs in the long-term.
8 0
3 years ago
Read 2 more answers
Anaerobic and aerobic exercises are important in developing cardiorespiratory fitness.
krok68 [10]
Yes - since they are in everyday fitness
7 0
3 years ago
Read 2 more answers
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
Other questions:
  • What is is the definition for protein
    9·1 answer
  • Define endorphins plzzzzzzz
    8·1 answer
  • Fruit bats hunt using their _______.
    7·1 answer
  • Which of these is a way to reduce the possibility of transmitting HIV? A. A mother with HIV breast-feeding her child B. Being in
    10·2 answers
  • Which of the following is true about fast-twitch muscle fibers?
    13·2 answers
  • Which is an internal factor that may influence one’s decision to have sex?
    15·2 answers
  • What percentage of teens use LSD? How many overdose?
    8·1 answer
  • Have you changed a baby’s diaper before?
    12·2 answers
  • Which situation is a barrier to eating healthy?
    7·2 answers
  • Briefly describe the purpose of an IACUC.
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!