It is false cause the embryo develops the baby into whatever mammal offspring is being born
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Autotrophs are the organisms which have ability make their own food using various sources of energy. Examples are can green plants and algae such as <em>Spirogyra, Chlorella, Volvox</em> make their food using sunlight carbon dioxide and water. they are photoautotrophs
Some bacteria are also make their food using chemical energy through oxidation. They are chemoautotrophs.
<span>The answer is tissue. Tissue is a group made up of specialized cells that are formed together according to each other's structure and function. There are fourn known types of tissue, such as the muscle, epithelial, connective and nervous tissues.</span>
