Answer:
Genes.
Explanation:
Genes are present on DNA that are inherited from parents to their offspring. Genes may be defined as the segment of DNA that ultimately form a particular protein product.
The particular trait of an organism is determined by the specific combination of the inherited genes. The genes are nearly same in all the human beings and there mutation can cause observable phenotype traits.
Thus, the correct answer is option (2).
Answer:
every answer of yours is correct
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Solar energy, Wind energy, Geothermal energy, Hydroelectric energy.
Explanation:
Have a nice day!