Muscles are required in breathing, talking, running, walking, and any body movement. Actin and myosins are protein filaments present in muscle cells that help to contract and relax or change the shape of muscles. Muscles are responsible for the movement or motion of organisms. Joints are the connection between two or more bones. Most joints are mobile.
Muscle strength is determined by several factors. Some of those are the physical shape, size, and innervation of the muscles.
Weak contraction
- Potassium accumulates in the sarcoplasm.
- Contracted lower sarcoplasm pH.
- Begin contraction with muscle already 50%.
- The circular arrangement of muscle fascicles.
Stronger contraction
- Increase in muscle belly circumference.
- A lesser proportion of motor neurons to muscle fibers.
- Increased recruitment.
- Increased stimulus frequency.
Answer: A chromosomes
Explanation: A chromosomes has a large strand of dna and is made up of many genes.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The correct answer among the choices provided is option A. Lung capillaries are responsible for exchanging carbon dioxide for oxygen from the air. Blood that comes from the heart gets oxygen from the alveoli. The carbon dioxide in the blood goes into the alveoli at the same time.
