Answer:
The Ancient Greeks developed astronomy, which they treated as a branch of mathematics, to a highly sophisticated level. The first geometrical, three-dimensional models to explain the apparent motion of the planets were developed in the 4th century BC by Eudoxus of Cnidus and Callippus of Cyzicus.
Explanation:
I hope it helped
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Plasmodesmata can change in number, and when dilated can provide a passageway macromolecules
Plasmodesmata are essential for the intercellular transfer of both big informational macromolecules like proteins and smaller signaling chemicals in plant cells.
- Plasmodesmata are membrane-lined structures that offer a high-conductance, aqueous channel for the transportation of information in the form of chemicals and macromolecules, such as transcription factors, from cell to cell.
- The intimate interaction of the plasma membrane with the endoplasmic reticulum results in the formation of plasmodesmata.
- The degree to which a particular cell acts as an individual or as a component of the entire organism is determined by the distribution and unitary conductance of plasmodesmata as well as other positional variables that affect development.
To learn more about Plasmodesmata visit ; brainly.com/question/28199815
#SPJ4
DNA is the ultimate control of cell's productions. So A.
Answer:
biliverdin
Explanation:
it's biliverdin, hope this helped!
