Answer:
3/4
Explanation:
If we assume simple dominance and independent assortment for each trait, we can use Mendel's Law of Segregation to predict the phenotypic proportions in the offspring of the parental cross AABBCc x AabbCc.
<h3><u>Gene A</u></h3>
AA x Aa
- F1 genotypes: 1/2 AA, 1/2 Aa
- F1 phenotypes: all A
<h3 /><h3><u>Gene B</u></h3>
BB x bb
- F1 genotypes: 1 Bb
- F1 phenotypes: all B
<h3 /><h3><u>Gene C</u></h3>
Cc x Cc
- F1 genotypes: 1/4 CC, 2/4 Cc, 1/4 cc
- F1 phenotypes: 3/4 C, 1/4 cc
We want to know the proportion of progeny with all dominant phenotype (A_B_C_). Since the genes are independent, we can multiply the probabilities of each gene to obtain the overall probability of having a ABC progeny:
<h3>1 A_ x 1 B_ x 3/4 C_ = 3/4 A_B_C_</h3>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Yes, they do eat turkey on thanksgiving unless they don't like the taste of it.
The answer is (A)
Hope this helps
Answer:
Amylose in starch is responsible for the formation of a deep blue color in the presence of iodine. The iodine molecule slips inside of the amylose coil. ... A blue-black color results if starch is present. If starch amylose is not present, then the color will stay orange or yellow. I hope this helps!
