Answer:
Promoter.
Explanation:
It is promoter because Promoter is a DNA sequence where's the gene transcription begins. It is the
DNA sequence which RNA polymerase binds or join to
so as to begin transcriptionn of a gene . It is a region where the regulatory elements i.e protein will bind to and the Promoter sequences are found directly upstream or at the end of 5' of the transcription initiation site. This can also encode RNA such as mRNA, trans and so on.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
DNA is the ultimate control of cell's productions. So A.
I believe its is because the fossils of these animals looked like living species and they had a connection to the modern. A fossil is any preserved evidence of life from a past geological age, such as the impressions and remains of organisms embedded in stratified rocks. Fossils are created when organisms die, are in cased in dirt and rock, and are slowly replaced by minerals over time.
I don’t know the second part, but algae growth will increase as a result of the fire
