Number the steps of the binary fission process in the correct order

1 answer:

5 0

Most bacteria rely on binary fission for propagation. Conceptually this is a simple process; a cell just needs to grow to twice its starting size and then split in two. But, to remain viable and competitive, a bacterium must divide at the right time, in the right place, and must provide each offspring with a complete copy of its essential genetic material. Bacterial cell division is studied in many research laboratories throughout the world. These investigations are uncovering the genetic mechanisms that regulate and drive bacterial cell division. Understanding the mechanics of this process is of great interest because it may allow for the design of new chemicals or novel antibiotics that specifically target and interfere with cell division in bacteria.

You might be interested in

How does the anaphase stage differ in the two phases of meiosis?

Ronch [10]

The answer is c. Anaphase I separates homologous chromosomes and anaphase II separates sister chromatids into daughter cells.

Meiosis is a cell division which results in the reduction of chromosome number by half (from diploid to haploid) in daughter cells. It consists of meiosis I and meiosis II.

In anaphase I, the sister chromatids separate from each other to the opposite sides of the cells. In meiosis I there are 46 chromosomes in duplicates which are present as pairs of sister chromatids. When comes to separation, homologous chromosomes separates only, but not sister chromatids. Homologous chromosomes are present only in meiosis I.

In anaphase II, since the cell is haploid, there are 23 chromosomes in duplicates, which are present as sister chromatids. So, in this phase, sister chromatids are those who separates.

4 0

3 years ago

Read 2 more answers

Whats the difference between ADP and ATP

zvonat [6]

ADP is adenosine diphosphate

ATP is adenosine triphosphate

Hope this helps

8 0

4 years ago

Can someone help me on this?

allsm [11]

I think the answer is B

3 0

3 years ago

Read 2 more answers

A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi

Digiron [165]

Answer:

Explanation:

ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.

4 0

3 years ago

Which is NOT a type of lipid? * Blubber Steroid Glycogen Phospholipid

Alex777 [14]

Answer:

i think it is glycogen

Explanation:

5 0

4 years ago