1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Vilka [71]
3 years ago
7

Given the ion C2O4-2, what species would you expect to form with each of the following ions?

Chemistry
1 answer:
Ksivusya [100]3 years ago
6 0

Answer:

A. K₂C₂O₄          Potassium oxalate

B. CuC₂O₄          Copper oxalate

C. Bi₂(C₂O₄)₃         Bismuth (III) oxalate

D. Pb(C₂O₄)₂         Lead (IV) oxalate

E. (NH₄)₂C₂O₄       Ammonium oxalate

F. HC₂O₄⁻             Acid oxalate

Explanation:

C₂O₄⁻²  → oxalate anion

This is the conjugate base from the H₂C₂O₄ which is the oxalic acid. A weak dyprotic acid that can release 2 protons.

A. 2K⁺  +  C₂O₄⁻²  → K₂C₂O₄          Potassium oxalate

It can be formed by the neutralization of the acid with the base

H₂C₂O₄  + 2KOH  → K₂C₂O₄  +  2H₂O

B. Cu²⁺ +  C₂O₄⁻²   ⇄  CuC₂O₄  ↓

This is a precipitate.

C.  2Bi³⁺  +  3C₂O₄⁻²   ⇄  Bi₂(C₂O₄)₃  ↓

This is a precipitate.

D.  Pb⁴⁺ +  2C₂O₄⁻²   ⇄  Pb(C₂O₄)₂  ↓

This is a precipitate.

E. 2NH₄⁺  +  C₂O₄⁻²   ⇄  (NH₄)₂C₂O₄  ↓

This is a precipitate.

F. This is the conjugate strong base, for the weak acid

H⁺  +  C₂O₄⁻²   ⇄  HC₂O₄⁻

HC₂O₄⁻  + H₂O  ⇄  C₂O₄⁻²  +  H₃O⁺    Ka

HC₂O₄⁻  + H₂O  ⇄  H₂C₂O₄  +  OH⁻    Kb

HC₂O₄⁻  is an amphoteric compound

You might be interested in
The most common cooling mechanism for cloud formation is ________.
KatRina [158]
The answer is "Rising and expanding air or atmosphere cooling".
To form a cloud the air must be cooled to the temperature of dew point. when there is expansion of air, it cools to the dew point and thus the formation of cloud happens. This process is very common and used for the formation of clouds.
8 0
3 years ago
Consider the following scenario
GarryVolchara [31]

Answer:

See explaination

Explanation:

Going by the clues that it is between Silver Flouride (AgF) and Sodium Fluoride (NaF) and since it is an aqueous solution , the 1 liter bottle is likely to be Sodium Chloride( NaCl). Going by the reaction,

AgF + NaCl= AgCl + NaF

Here, the color of AgCl is white, hence the solution cannot be AgCl.

Determination of NaCl

Determination of NaCl can be done by Mohr's Method or Volhard's method. But results in Volhard's method are more accurate . Its uses the method of back titration with Potassium Thiocynate which forms a AgCl precipitate . Prior to titration,excess AgNO3 ( The problem also has a clue that excess reagents are present in the lab ) is added to the NaCl solution so that all the Cl- ions react with Ag+. Fe3+ is then added as an indicator and the solution is titrated with KSCN to form a silver thiocyannite precipitate (AgSCN). Once all the silver has reacted, a slight excess of SCN- reacts with Fe3+ to form Fe(SCN)3 dark red complex. The concentration of Cl- is determined by subtracting the titer findings of Ag+ ions that reacted to form AgSCN from the Ag NO3 moles added to the solution. This is used because pH of the solution is acidic. If the pH of solution is basic, Mohr's method is used.

Reactions

Ag+ (aq)+ Cl-(aq) = AgCl(aq)

Ag+(aq) + SCN-(aq) = AgSCN(aq)

Fe3+(aq) + SCN-(aq) = [FeSCN]2- (aq)

7 0
3 years ago
In one to two sentences, describe an experiment that would show that intramolecular forces (attractions between atoms within mol
Tatiana [17]

An experiment that would show that intramolecular forces are stronger than intermolecular forces will be heating a block of ice in a sealed container then allowing it to change to steam.

Intramolecular forces are the forces of attraction that hold atoms together within a molecule. Intramolecular forces require a high amount of energy to splits atoms or molecules in a chemical bonding.

Intermolecular forces are weaker forces of attraction that occur between molecules. They require lesser energy to splits molecules compared to intramolecular forces.

An experiment that would show that intramolecular forces are stronger than intermolecular forces will be heating a block of ice in a sealed container then allowing it to change to steam.

In the process, the energy required to change the state from ice to steam water is more than intermolecular forces.

Thus, we can conclude that this experiment shows that the intramolecular forces are stronger than the intermolecular forces.

Learn more about Intramolecular forces here:

brainly.com/question/13588164

3 0
2 years ago
The density of pentanol, C3H20, is 0.8110 g/mL. Calculate the volume occupied by 7.455 moles of pentanol. What is the volume occ
lozanna [386]

Answer:

i dont no ehh ahh i answer this question and this question is an dibitual sence

Explanation:

ahahalsbaowvapnavskqleveywpwndvsmavalsnsbalsmbsiabsopqmgdijsbsiwbskwnvskabhsksn

mabahslambbsoalnqnmlpigfqjskbdnmxnxb slabslwobdksjwmsnmaksbkakskslanksoqlmmbsjpqloyewqasfhjllmvxxwtyipeorirubamsbsmsnsmsoandbaksnsgaks

7 0
3 years ago
Which group will have a charge of +2 when ionized?
inysia [295]

Answer:

Alkaline earth metals

Explanation:

Group 2 has 2 valence electrons that they lose when being ionized, thus making  their charge 2+.

5 0
3 years ago
Read 2 more answers
Other questions:
  • Critical practices to control the amount of solid waste include __________.
    9·2 answers
  • A doubling of the concentration of a doubles the rate of the reaction. true or false
    13·1 answer
  • Which of the following is true of science? (2 points)
    14·1 answer
  • A protein subunit from an enzyme is part of a research study and needs to be characterized. A total of 0.150 g of this subunit w
    12·1 answer
  • A beaker contains 450 g of water (H2O). If 9.2 g of calcium fluoride (CaF2) is added, what is the molality concentration of the
    8·1 answer
  • Help please? :)
    10·2 answers
  • What are the possible values of ml for l=2<br> ​
    6·1 answer
  • Help ASAP I will mark brainliest for the correct answer !!!⚡️⚡️⚡️
    7·1 answer
  • Which of these ingredients is important in making plastics?
    7·1 answer
  • Why is helium found in deposits of uranium and thorium vores? What kind of radioactive emission produces it?
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!