Answer:
Cell theory is not a law because cell theory does not have enough support to become a law.
Explanation:
Hope this helps.
The best answer to the question above would be letter d. The sentence presented which is 'Researchers helped further the biological perspective when they demonstrated that electrical stimulation of the brain could evoke emotional responses in animals.' demonstrates how new discoveries can influence perspectives.
I'm certain the answer is liquid. I hope this helps you! <3
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
