Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
true? i dont understand what you are asking?......
Hi there!
Active Transport - Through the use of ATP, active transport pumps molecules against a particular concentration gradient. Active transport occurs from a low concentration solute and moves to a high concentration of solute. Two examples of active transport would be endocytosis and exocytosis.
Passive Transport - Active transport is the movement of molecules down a gradient. Unlike passive transport, it goes from high to low concentration and does not require energy (such as cellular energy). Some examples would be osmosis and diffusion.
I hope this helped!
Answer:
Along with evaporation and condensation, precipitation is one of the three major parts of the global water cycle. Precipitation forms in the clouds when water vapor condenses into bigger and bigger droplets of water. When the drops are heavy enough, they fall to the Earth.
Explanation:
from national geographic yw
