Answer:
you can't see sickle cell in a karyotype a it is inside one of the chromosomes
it is a single gene disorder
Explanation:
The genetic variation occurs due to induced changes to the genome from environmental factors, fertilization of two haploid gametes during gamete fusion. The correct options are D and E.
<h3>What is genetic variation?</h3>
The presence of differences in gene sequences between individual organisms of a species is referred to as genetic variation. It allows for natural selection, which is one of the primary forces driving life's evolution.
The genetic variation occurs due to induced changes to the genome from environmental factors, fertilization of two haploid gametes during gamete fusion.
Thus, the correct options are D and E.
For more details regarding genetic variation, visit:
brainly.com/question/848479
#SPJ1
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Photosynthesis
Explanation:
Breaking down sugar, locomotion, copying its own DNA, allowing certain substances to pass through the cell membrane while keeping others out.
