Photosynthesis<span> makes the glucose that is used in </span>cellular respiration<span> to make ATP. The glucose is then turned back </span>into <span>carbon dioxide, which is used in </span>photosynthesis<span>. While water is broken down to form oxygen </span>during photosynthesis, in cellular respiration<span> oxygen is combined </span>with<span> hydrogen to form water.
</span><span>
</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
A metallurgical microscope
Yes they would help predict and explain patterns of change in the size of populations for other large consumers.
<h3>What is Population?</h3>
This is defined as the total number of organisms in an area over a given period of time.
The population of producers and primary consumers help predict that of larger consumers. The higher their population, the lesser the population of large consumers that live in the Serengeti ecosystem.
Read more about Population here brainly.com/question/13403673
#SPJ1
