Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
The lab value that does not support this diagnosis is a hemoglobin level of 18g per decilitre. Anemia is a mid-severe disease.
<h3>Hemoglobin and anemia</h3>
Hemoglobin is a fundamental protein located in red blood cells, which acts to transport oxygen to all body cells.
Low levels of hemoglobin in blood are indicative of anemia.
Anemia is a disease caused by defective red blood cells, which hampers their ability to transport oxygen in the bloodstream.
Learn more about anemia here:
brainly.com/question/377481
Medulla which is also part of the brain stem so your answer is brain stem :D<span />
Maybe by giving more benefits like health care and more discounts.