Answer:
X+190=7602
X=7412
Step-by-step explanation:
The odometer read 7412 miles at the beginning of the trip.
Answer:
y + 1 = 8/9(x +4)
Step-by-step explanation:
Find the slope: [7- (-1)]/ [5 - (-4)] = 8/9
Using (-4, -1)
y-(-1) = 8/9[x- (-4)]
y + 1 = 8/9(x +4)
The common ratio of the given geometric sequence is the number that is multiplied to the first term in order to get the second term. Consequently, this is also the number multiplied to the second term to get the third term. This cycle goes on and on until a certain term is acquired. In this item, the common ratio r is,
r = t⁵/t⁸ = t²/t⁵
The answer, r = t⁻³.
The next three terms are,
n₄ = (t²)(t⁻³) = t⁻¹
n₅ = (t⁻¹)(t⁻³) = t⁻⁴
n₆ = (t⁻⁴)(t⁻³) = t⁻⁷
The answers for the next three terms are as reflected above as n₄, n₅, and n₆, respectively.
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
