1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Tanzania [10]
3 years ago
7

Explain how a carbon atoms moves From primary consumers to secondary consumers

Biology
1 answer:
kirill115 [55]3 years ago
5 0

Answer:

There are a few types of atoms that can be a part of a plant one day, an animal the next day, and then travel downstream as a part of a river’s water the following day. These atoms can be a part of both living things like plants and animals, as well as non-living things like water, air, and even rocks. The same atoms are recycled over and over in different parts of the Earth. This type of cycle of atoms between living and non-living things is known as a biogeochemical cycle.

All of the atoms that are building blocks of living things are a part of biogeochemical cycles. The most common of these are the carbon and nitrogen cycles.

Tiny atoms of carbon and nitrogen are able to move around the planet through these cycles. For example, an atom of carbon is absorbed from the air into the ocean water where it is used by little floating plankton doing photosynthesis to get the nutrition they need. There is the possibility that this little carbon atom becomes part of the plankton’s skeleton, or a part of the skeleton of the larger animal that eats it, and then part of a sedimentary rock when the living things die and only bones are left behind. Carbon that is a part of rocks and fossil fuels like oil, coal, and natural gas may be held away from the rest of the carbon cycle for a long time. These long-term storage places are called “sinks”. When fossil fuels are burned, carbon that had been underground is sent into the air as carbon dioxide, a greenhouse gas.

Recently, people have been causing these biogeochemical cycles to change. When we cut down forests, make more factories, and drive more cars that burn fossil fuels, the way that carbon and nitrogen move around the Earth changes. These changes add more greenhouse gases in our atmosphere and this causes climate change.

The element carbon is a part of seawater, the atmosphere, rocks such as limestone and coal, soils, as well as all living things. On our dynamic planet, carbon is able to move from one of these realms to another as a part of the carbon cycle.

Carbon moves from the atmosphere to plants. In the atmosphere, carbon is attached to oxygen in a gas called carbon dioxide (CO2). Through the process of photosynthesis, carbon dioxide is pulled from the air to produce food made from carbon for plant growth.

Carbon moves from plants to animals. Through food chains, the carbon that is in plants moves to the animals that eat them. Animals that eat other animals get the carbon from their food too.

Carbon moves from plants and animals to soils. When plants and animals die, their bodies, wood and leaves decays bringing the carbon into the ground. Some is buried and will become fossil fuels in millions and millions of years.

Carbon moves from living things to the atmosphere. Each time you exhale, you are releasing carbon dioxide gas (CO2) into the atmosphere. Animals and plants need to get rid of carbon dioxide gas through a process called respiration.

Carbon moves from fossil fuels to the atmosphere when fuels are burned. When humans burn fossil fuels to power factories, power plants, cars and trucks, most of the carbon quickly enters the atmosphere as carbon dioxide gas. Each year, five and a half billion tons of carbon is released by burning fossil fuels. Of this massive amount, 3.3 billion tons stays in the atmosphere. Most of the remainder becomes dissolved in seawater.

Carbon moves from the atmosphere to the oceans. The oceans, and other bodies of water, absorb some carbon from the atmosphere. The carbon is dissolved into the water.

Carbon dioxide is a greenhouse gas and traps heat in the atmosphere. Without it and other greenhouse gases, Earth would be a frozen world. But since the start of the Industrial Revolution about 150 years ago humans have burned so much fuel and released so much carbon dioxide into the air that global climate has risen over one degree Fahrenheit. The atmosphere has not held this much carbon for at least 420,000 years according to data from ice cores. The recent increase in amounts of greenhouse gases such as carbon dioxide is having a significant impact on the warming of our planet.

Carbon moves through our planet over longer time scales as well. For example, over millions of years weathering of rocks on land can add carbon to surface water which eventually runs off to the ocean. Over long time scales, carbon is removed from seawater when the shells and bones of marine animals and plankton collect on the sea floor. These shells and bones are made of limestone, which contains carbon. When they are deposited on the sea floor, carbon is stored from the rest of the carbon cycle for some amount of time. The amount of limestone deposited in the ocean depends somewhat on the amount of warm, tropical, shallow oceans on the planet because this is where prolific limestone-producing organisms such as corals live. The carbon can be released back to the atmosphere if the limestone melts or is metamorphosed in a subduction zone.

You might be interested in
Ticks feed on deer blood to the deers that detriment
Montano1993 [528]
This is known as parasitism. 
In biology, parasitism is a relationship between species, where one organism, the parasite, lives on or in another organism, the host, causing it some harm, and is adapted structurally to this way of life.
6 0
4 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
4 years ago
The ___[x]_______ secretes hormones that control other glands such as the thyroid, ovaries, and testes.
uranmaximum [27]
Endocrine glands secrete glands
6 0
4 years ago
Read 2 more answers
The atmosphere of earth is comprised mostly of oxygen and
erastovalidia [21]

Answer:

Nitrogen

Explanation:

The air in the atmosphere is made out of 78% Nitrogen, 21% oxygen, and 1% other gases.

4 0
3 years ago
The fast axoplasmic transport includes proteins from the __________ and transported on ___________. The slow axoplasmic transpor
soldi70 [24.7K]

Answer:

a. RER, microtubules, cytoplasm

Explanation:

The axoplasmic transport or axonal transport that moves the material at the rate of 1-5 mm/day is called slow axoplasmic transport. This system serves to deliver the materials required for regeneration of axons and axoplasm. It includes the movement of proteins from cytoplasm along the axon.

On the other hand, the fast axoplasmic transport moves the material at the rate of 200-400 mm/day. It serves to transport integral membrane proteins and secretory proteins formed on RER. The fast movement occurs with the help of motor proteins that move the material along the surface of microtubules present in the cytoskeleton of neurons.  

6 0
3 years ago
Other questions:
  • Although cells have differences that reflect their specific functions in the body, what functions do they have in common?
    12·1 answer
  • Soils vary throughout the world because _____.
    9·2 answers
  • A material you are testing conducts electricity but cannot be pulled into wires. It is most likely a _____.
    9·2 answers
  • An example of a food chain where pillbugs play a part.
    7·1 answer
  • A toy boat is floating in a large metal bucket. if you build a fire under the bucket, how will most of the heat be tranferred fr
    15·1 answer
  • MMMMMM! Dinner's cooking. Soon we'll be eating some chicken and dumplings. Our digestive system will get to work on the food we
    13·2 answers
  • Some studies have indicated that our eyes naturally travel from bottom left to top right, so putting the diagonal along that pat
    5·2 answers
  • What are the passing of physical characteristics from parent to young is called?
    14·1 answer
  • What did dinosaurs do for their young
    6·1 answer
  • What is the name for the rafflesia's organism
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!