Answer:
Sorry im late but it would be photosynthetic cells.
Researching is composed of various explorations in utilizing the scientific method in the process. It also, answers any scientific inquiry with the use of scientific method. Research enables and promotes the scientific community at a larger scale. Contributing and collaborating knowledge all-over the people and persons in science. Researches play a big role in everyone’s academic identity because
<span>1. It actively makes the individual scientific in approach to things of curiosity and makes him/her use the knowledge to study and produce results which</span> <span>
2. The scientific society will benefit by this particular study and can work together to better explore and discover. </span><span> </span>
As the years increase the deer population increases.
As the years increase the the wolf decreases
<span>The footprints of a dinosaur are an example of what type of fossil?
D. Trace Fossil
</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
