Answer: Holism
Explanation:
Holism is a theory which suggests that parts of the organism are connected, these cannot function independently but as a part of whole organism.
This can be understood as organism as whole is greater than the sum of its parts.
Thus everything about an organism can be understood through the components that is if a person is suffering from brain disease then this may affect the control and coordination of the body this is likely to affect the whole organism.
Answer:
An aminoacyl-tRNA synthetase (aaRS or ARS), also called tRNA-ligase, is an enzyme that attaches the appropriate amino acid onto its corresponding tRNA. It does so by catalyzing the transesterification of a specific cognate amino acid or its precursor to one of all its compatible cognate tRNAs to form an aminoacyl-tRNA.
Heart,vessels,circulating fluids
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Describe the initial conditions.
The tubing contains
A) starch solution
beaker contains
B) lugol's solution
Describe the final conditions
The tubing contains
C) starch solution and Lugol's solution
beaker contains
A) only Lugol's solution
Explanation: