1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
marishachu [46]
3 years ago
5

Anyone wants to talk

Biology
2 answers:
Travka [436]3 years ago
8 0
Nope you noob of pubg/free fire/codm
DaniilM [7]3 years ago
3 0

Answer:

me i do

Explanation:

You might be interested in
_____________ is the view that not everything about an organism can be understood or predicted from the knowledge of its compone
mamaluj [8]

Answer: Holism

Explanation:

Holism is a theory which suggests that parts of the organism are connected, these cannot function independently but as a part of whole organism.

This can be understood as organism as whole is greater than the sum of its parts.

Thus everything about an organism can be understood through the components that is if a person is suffering from brain disease then this may affect the control and coordination of the body this is likely to affect the whole organism.

3 0
3 years ago
Read 2 more answers
From a chemical view, how is an amino acid is being recognized by its specific aminoacyl tRNA synthetase?
nydimaria [60]

Answer:

An aminoacyl-tRNA synthetase (aaRS or ARS), also called tRNA-ligase, is an enzyme that attaches the appropriate amino acid onto its corresponding tRNA. It does so by catalyzing the transesterification of a specific cognate amino acid or its precursor to one of all its compatible cognate tRNAs to form an aminoacyl-tRNA.

5 0
3 years ago
which three components are common to the circulatory systems of most living things                                    PLZZ I WIL
gavmur [86]
Heart,vessels,circulating fluids
3 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Describe the final conditions.
natka813 [3]

Answer:

Describe the initial conditions.

The tubing contains

A) starch solution

beaker contains

B) lugol's solution

Describe the final conditions

The tubing contains

C) starch solution and Lugol's solution

beaker contains

A) only Lugol's solution

Explanation:

7 0
3 years ago
Other questions:
  • During which process do hapolid cells become diploid?
    6·2 answers
  • Are leaves changing color a chemical change
    10·1 answer
  • These are The questions need help on numbers 1-6 please use The passage picture To help answer The questions
    5·1 answer
  • The lipid bilayer molecules do what for the cell?
    8·1 answer
  • A tree of life depicting the hypothetical phylogeny of the three domains is shown above. At which letter is located the common a
    10·2 answers
  • What is most likely a product of an early gene?
    9·1 answer
  • If a purple plant cross-breeds with a yellow plant and almost all of the resulting "child" plants are yellow, which is the domin
    7·2 answers
  • I AM TREMENDOUSLY CONFUSED!!! pls help?!?!
    7·1 answer
  • Which of the following is not a main characteristic of a mineral?
    13·1 answer
  • Which macromolecule group is rice apart of?
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!