Answer:
Documentation,link section ,definition section ,main function ,etc
Answer:
a control
Explanation:
you need something to compare it to to see if anything happens
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Virus are living because they:
Reproduce, have Genetic Material (Nucleic Acids) and Adapt
.
Explanation:
Virus have genes or genetic material which are layered in a capsid or protein coat and sometimes a lipid bilayer.
It is not made up of cells yet can be considered a living organism because of the genetic material RNA or DNA in it.
The infect the host and take over host replication machinery and replicates itself. Although it is not able to replicate outside the living body.
They adapt to the host's body environment as many adaptation are present in it as capsid layer which protects its genetic material from getting degrade till the time it reaches nucleus of the cell.
There are 7 point criteria for an organism to be living, virus fulfils some of it except having made up of cells and having cellular organization.
