Answer:
.I do not have an answer for this
Answer:
5 hi hi hi hi hi hi hi hi hi hi hi hi
Answer:
Sulfur; nitrogen.
Explanation:
Acid precipitation results when sulfur and nitrogen compounds react with water in the atmosphere.
This acid precipitation is also known as acid rain and it is typically caused by the chemical reaction between sulfur oxide and nitrogen oxide which are released into the air as a result of burning fossil fuels, with water and other chemical elements present in the atmosphere.
Generally, acid precipitation (acid rain) usually have a pH of about 5.1 or below and as such, it is very acidic nature i.e possessing a large amount of hydrogen ions.
Hence, acid precipitation (acid rain) when washed to the earth has negative or harmful effects on various living and non-living organisms such as animals, plants, cars, buildings etc.
Answer:
cytosol (intracellular fluid), interstitial fluid, plasma
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
