Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
I believe the correct answer is a. mutations.
The book gives you more information and instructions then the television
Answer:
La respuesta correcta es "a. arterias, b. venas; y c. capilares".
Explanation:
Los vasos sanguíneos son una serie de conductos a través de los cuales el cuerpo transporta la sangre, asegurando que todas las células del cuerpo tenga acceso a oxígeno, elemento necesario para la respiración celular. Hay tres tipos de vasos sanguíneos: arterias, venas y capilares. Las arterias llevan la sangre del corazón a los órganos, las venas transportan la sangre de los órganos al corazón y los capilares son vasos muy pequeñitos que llegan a las partes más pequeñas del cuerpo.
