Nutrient Leaching
Leaching is the process where dissolved nutrients in the
soil profile moves downward with percolating water. It is the loss of
water-soluble plant nutrients from the soil. The nutrients that seep through
the rooting zone may be recycled if roots grow deeper.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Jan Ingenhousz discovered photosynthesis
The both decrease genetic variation
For most prokaryotes, they do not contain a nucleus.
The correct answers would be :
A) cell membrane
C) cytoplasm
D) DNA
E) ribosomes
