1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Ilia_Sergeevich [38]
3 years ago
10

What effects might climate change have on terrestrial ecosystems? What effects might there

Biology
2 answers:
avanturin [10]3 years ago
4 0

Answer:

Well,

Explanation:

Aquatic ecosystems are critical components of the global environment. In addition to being essential contributors to biodiversity and ecological productivity, they also provide a variety of services for human populations, including water for drinking and irrigation, recreational opportunities, and habitat for economically important fisheries. However, aquatic systems have been increasingly threatened, directly and indirectly, by human activities. In addition to the challenges posed by land-use change, environmental pollution, and water diversion, aquatic systems are expected to soon begin experiencing the added stress of global climate change.

“Aquatic Ecosystems and Global Climate Change” is the seventh in a series of reports examining the potential impacts of climate change on the U.S. environment. It details the likely impacts of climate change over the next century on U.S. aquatic ecosystems. Report authors, Drs. N. LeRoy Poff, Mark Brinson, and John Day, Jr. find:

Increases in water temperatures as a result of climate change will alter fundamental ecological processes and the geographic distribution of aquatic species. Such impacts may be ameliorated if species attempt to adapt by migrating to suitable habitat. However, human alteration of potential migratory corridors may limit the ability of species to relocate, increasing the likelihood of species extinction and loss of biodiversity.

Changes in seasonal patterns of precipitation and runoff will alter hydrologic characteristics of aquatic systems, affecting species composition and ecosystem productivity. Populations of aquatic organisms are sensitive to changes in the frequency, duration, and timing of extreme precipitation events, such as floods or droughts. Changes in the seasonal timing of snowmelt will alter stream flows, potentially interfering with the reproduction of many aquatic species.

Climate change is likely to further stress sensitive freshwater and coastal wetlands, which are already adversely affected by a variety of other human impacts, such as altered flow regimes and deterioration of water quality. Wetlands are a critical habitat for many species that are poorly adapted for other environmental conditions and serve as important components of coastal and marine fisheries.

Aquatic ecosystems have a limited ability to adapt to climate change. Reducing the likelihood of significant impacts to these systems will be critically dependent on human activities that reduce other sources of ecosystem stress and enhance adaptive capacity. These include maintaining riparian forests, reducing nutrient loading, restoring damaged ecosystems, minimizing groundwater withdrawal, and strategically placing any new reservoirs to minimize adverse effects.

Serggg [28]3 years ago
3 0

Answer:

Climate change can alter where said species live, interact with other species and each other, it also depends on the timing on the biological events that has occurred/occuring.

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Ordering Components of a River System
garri49 [273]

Answer:

Tributary-river-river system

i think this is the answer

Explanation:

5 0
3 years ago
Read 2 more answers
What happens to a plant's color in the fall? Select the two correct answers. A. The leaves become very green as more chlorophyll
Paladinen [302]
To me I think the answer is b and c
7 0
3 years ago
Read 2 more answers
How do heredity and inheritance relate to the data presented In these charts
Makovka662 [10]
Hereditary is Breast cancer and Inheritance is
Getting Breast Cancer basically it runs in the family inheriting.
3 0
3 years ago
Read 2 more answers
Give one example of a bad mutation and one example of a good mutation.!
topjm [15]

Answer:

Bad mutation: deletion/addition mutation

Good mutation: silent mutation

Explanation:

Addition or deletion mutation results in the reading frame of codons to be changed, leading to a extensive missense mutation that will lead to a non-functional protein product to form.

Good mutation are silent mutations that leads to no change to the final product but causes codons to change in sequence. This increases genetic diversity in the gene pool that enables the species to be more resilient to environmental changes.

5 0
2 years ago
Other questions:
  • According to the phylogeny tree, which phylum of organisms are most closely related to chordates?
    13·1 answer
  • Which biological process takes advantage of chemical bonds
    10·1 answer
  • What is the correct way to handle a needle after it is used to give a vitamin injection to a health patient?
    14·1 answer
  • Bacteria live in the roots of plants and help the plants to get nutrients. What type of
    6·1 answer
  • El líquido que protege al sistemas nervioso central es ​
    14·1 answer
  • The plasma membrane is composed of a phospholipid by layer with embedded proteins what is one of the functions of the embedded p
    12·1 answer
  • According to the cell theory, all cells come from __________ cells.<br> A. existing<br> B.fertile
    7·2 answers
  • a hunter illegally kills a wolf in yellowstone national park and attempts to bring the wolf's skull back to florida. which law i
    8·2 answers
  • Plz help I need this done by Monday​
    8·2 answers
  • Respiration needs light to occur just as photosynthesis needs light true or false​
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!