Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
Answer:
m=7
Step-by-step explanation:
Answer:
37.5%
Step-by-step explanation:
Ratio = 3 : 5
Total part = 3 +5 = 8
Chocolate donuts = 3/8

= 37.5 %
The practical domain is all real numbers from 4 to 9, inclusive.
The practical range is all real numbers from 49.6 to 111.6, inclusive.
These are the correct options.
Explanation:
Given function is f(t) = 12.4t
Let us assume that Nate works 'x' hours so 4<x<9
And multiplying the hours with his earnings we get the range.
4*12.40=49.6 and 9*12.40=111.6. Let the amount earned be represented by y
Hence, domain can be represented as 4<x<9 and range can be represented as 49.6 < y < 111.6