1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Licemer1 [7]
2 years ago
13

Use the x-intercept method to find all real solutions of the equation.

Mathematics
1 answer:
Dima020 [189]2 years ago
4 0

Answer:

<h3>D,x=-1,2,or 5</h3>

<h3>Step-by-step explanation:</h3>

<h3>1. Factor x³-6x² + 3x + 10 = 0</h3>

(x + 1)(x + 2)(x + 5)=0

<h3>2. Using the Zero Factor Principle : If ab=0 then a=0 or b=0</h3>

x + 1 = 0 or x - 2 = 0 or x - 5 = 0

  • Solve x + 1 = 0 : x = -1
  • Solve x - 2 = 0 : x = 2
  • Solve x - 5 = 0 : x = 5

<h3>The solutions are</h3>

x = -1 , x = 2 , x = 5

You might be interested in
Helpppppppppppppppppppppppppp
noname [10]

Answer:

F

Step-by-step explanation:

So lets use the process of elimantion to find the answer.

Firs off, we can tell that this is a greater/less than or equal to inequlaity, since there is a inclosed circle, not a open one. So this leaves the top left answer and bottem right answer.

Now, we can see that the graph is from 0-15. X is at 7.

This means its x+8, because the x would be smaller, or possibly even negatibe on this graph.

My theory that can better support my annwer is if we solve for  x:

x+8=15

We can subtract 8 from both sides:

x=7

And as we can see on the inequality, x is at 7 in the graph.

Hope this makes sense and helps!

6 0
3 years ago
Determine the domain and range of the given function.<br> The domain is<br> The range is
astra-53 [7]
What is the function?
6 0
4 years ago
Read 2 more answers
I need help please
Dima020 [189]

It's either A or D.

6 0
4 years ago
Read 2 more answers
What one is going slower​
ddd [48]
Car A is going slower
8 0
3 years ago
Read 2 more answers
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
3 years ago
Read 2 more answers
Other questions:
  • Solve the System by Substitution<br> by<br> X = 2y - 3<br> 4x - 5y = -3<br> X=<br> Y=
    9·1 answer
  • Replace ? With =,&gt;, or &lt; to make the statement true (4+6)-3?9+2-8 divides by 2
    5·1 answer
  • 1.) A single ticket to the fair cost $6. A family pass costs $32 more
    5·1 answer
  • What is the expanded form for 11,760,825
    8·1 answer
  • The coordinates below represent two linear equations. How many solutions does this system of equations have?
    11·1 answer
  • The surface area of a sphere is 3000 m square units. What is the volume of the sphere to the nearest hunderedth?
    10·1 answer
  • Find the following when a = -1, b = 2, c = -1/4<br> (4b - 3)/(2a) -1
    15·1 answer
  • Jorge's home run total last month was: 3, 6, 4, 3, 2, 3, 1, 0, 3. What is the mean?
    11·2 answers
  • The table shows the approximate calorie count of each ingredient in Buddy’s breakfast. The average person should consume about 2
    13·1 answer
  • If A=(0,0) and B=9(2,5), what is the approximate length of AB
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!