1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Nimfa-mama [501]
3 years ago
10

Cindy is 5 feet 6 inches tall and weighs 92 pounds. she is very concerned about her weight. however, at times she finds herself

eating large amounts of food—several boxes of cookies, gallons of ice cream, entire cakes—all in an evening. afterwards, she makes herself throw up. cindy's most likely diagnosis is ________
Biology
1 answer:
Sliva [168]3 years ago
7 0
<span>bulimia nervosa
</span><span>
also known as simply bulimia, is an eating disorder characterized by binge eating followed by purging. Binge eating refers to eating a large amount of food in a short amount of time. Purging refers to the attempts to get rid of the food consumed. This may be done by vomiting or taking laxatives</span>
You might be interested in
PLEASE HELP I AM RUSHING ON WORK !!!
BabaBlast [244]

Answer:

True; all cells in a mature embryo can develop into muscle.

Explanation:

8 0
3 years ago
Why do the complex sugar disaccharides store more energy than monosaccharides
aksik [14]
Because Disaccharides have more chemical bonds. 
5 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Weigh is a measure of pull of gravity on an object true or false
user100 [1]

Answer:

The answer is "TRUE!"

Explanation:

Weight is a source of forceful motion that is generated by the pull of gravity. Gravity that is originated in the center of the earth, attracts smaller objects towards that center, in which the measurement of how strong that force really is, is weight.

3 0
3 years ago
Read 2 more answers
EXPLAIN whether the problem of elephants destroying trees in southern Africa is due to overpopulation, competition, or both.
vlabodo [156]
Both because they are vegetarian and they are reproducing more so they do have to compete for food
8 0
3 years ago
Other questions:
  • Which ecosystem has more biodiversity EXPLAIN!
    13·1 answer
  • Which of the following statements is correct? See Concept 32.4 (Page 680) View Available Hint(s) Which of the following statemen
    10·1 answer
  • A plant with seed but lack flower and fruit is under what group <br><br>​
    12·2 answers
  • Which phylum is a group of miscellaneous fungi that don’t fit into the other three categories? Zygomycotes Deuteromycotes Ascomy
    12·1 answer
  • A ______________ causes a living organism to react. A) population B) stimulus C) system D) variation
    6·1 answer
  • Help please and thank you
    5·2 answers
  • You are already familiar with the fact that different organisms often exhibit common adaptations that help them succeed in a giv
    15·1 answer
  • What characteristics do only vertebrates have?
    9·1 answer
  • 15. The RQ is less than 1 when ......fats are
    6·1 answer
  • Study the picture carefully. Is there any relationship between the type of teeth and the food of the animal? Explain. ( The one
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!