Answer:
True; all cells in a mature embryo can develop into muscle.
Explanation:
Because Disaccharides have more chemical bonds.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The answer is "TRUE!"
Explanation:
Weight is a source of forceful motion that is generated by the pull of gravity. Gravity that is originated in the center of the earth, attracts smaller objects towards that center, in which the measurement of how strong that force really is, is weight.
Both because they are vegetarian and they are reproducing more so they do have to compete for food