As I am not to familiar cell plant to the looks precise the leaf shape on option A. Please dear correct me if I’m incorrect!
<span>Glycolysis
4 made - 2 used= 2 ATP substrate level
2 NADH x 2= <span>4 ATP </span>(enters at complex II)
Pyruvate Decarboxylation
1 NADH x two pyruvate= 2 NADH x 3= 6 ATP
Krebs Cycle
3 NADH x two pyruvate= 6 x 3= 18 ATP
1 GTP x two pyruvate= 2 GTP= 2 ATP
1 FADH2 x two pyruvate= 2 FADH2 x2= 4 ATP
Total: 2+4+6+18+2+4= 36 ATP</span>
Answer:
A diving regulator is a pressure regulator that reduces the pressure of gas in the tank and deliver it to the diver so that he/she can breathe easily. It must pass the controlled laboratory testing and must have a second adjustment knob to ensure ease of breathing. Modern regulators are precision made and designed to work under demanding conditions. 1st stage and 2nd stage, diaphragm and piston, exhaust valve and purge button are types of diving regulators.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Root nodules
You can also just find this on google
