1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
malfutka [58]
3 years ago
5

Mrs. Mitchell was hospitalized after being found unconscious in her home. A dietitian conducted a nutritional assessment noting

the general appearance of Mrs. Mitchell's skin, eyes, and tongue. Which part of the assessment is this?
a) Medical examination
b) Diet history
c) Biochemical evaluation
d) Clinical examination
Biology
1 answer:
inessss [21]3 years ago
6 0

Answer: d) Clinical examination

Explanation:

A clinical examination is a physical examination of the body which is usually done without any surgery. It notices the external characteristics and internal characteristics of body specially by using the diagnostic tests such as x-rays, MRI and others. This is done to determine the cause of disease and disorder.

The given assessment is the part of the clinical examination because external features such as skin, eyes and tongue can be examined in a clinical study to identify the disease or disorder and it's cause.    

You might be interested in
Identify organelles in a plant cell.
PolarNik [594]
As I am not to familiar cell plant to the looks precise the leaf shape on option A. Please dear correct me if I’m incorrect!
6 0
2 years ago
How many atp are generated in the electron transport chain?how many atp are generated in the electron transport chain?v
siniylev [52]
<span>Glycolysis
4 made - 2 used= 2 ATP substrate level
2 NADH x 2= <span>4 ATP </span>(enters at complex II)

Pyruvate Decarboxylation
1 NADH x two pyruvate= 2 NADH x 3= 6 ATP

Krebs Cycle
3 NADH x two pyruvate= 6 x 3= 18 ATP
1 GTP x two pyruvate= 2 GTP= 2 ATP
1 FADH2 x two pyruvate= 2 FADH2 x2= 4 ATP

Total: 2+4+6+18+2+4= 36 ATP</span>
8 0
3 years ago
Read 2 more answers
The single most important feature to consider when purchasing a scuba regulator is: How well it performs in controlled laborator
serg [7]

Answer:

A diving regulator is a pressure regulator that reduces the pressure of gas in the tank and deliver it to the diver so that he/she can breathe easily. It must pass the controlled laboratory testing and must have a second adjustment knob to ensure ease of breathing. Modern regulators are precision made and designed to work under demanding conditions. 1st stage and 2nd stage, diaphragm and piston, exhaust valve and purge button are types of diving regulators.

8 0
2 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
All of the following remove nitrogen from the nitrogen cycle except
kenny6666 [7]
Root nodules
You can also just find this on google
8 0
3 years ago
Other questions:
  • During embryonic development, the mesodermal tissue splits to form the coelom. Which type of invertebrate does this statement de
    5·1 answer
  • Which of the following is not caused by human interactions with the earth system
    13·2 answers
  • Which of the following statements about this diagram is true?
    15·1 answer
  • The cellular process that enables the cells to grow and develop into tissue is
    10·2 answers
  • Identify at least two food chains represented in the food web below.
    13·2 answers
  • A diploid cell in a plant undergoes chromosome duplication but fails to divide properly, initiating a tetraploid (4n) branch. Th
    14·1 answer
  • In many cities, wastewater travels through sewer lines to be processed at a
    11·1 answer
  • Cell ______ is the process during which cells become progressively restricted in their developmental potential.
    6·2 answers
  • What are some sources of CO2?
    8·2 answers
  • ____ is the species that plays an especially important role in its community so that major changes in its numbers affect the pop
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!